Recombinant fragment corresponding to Human C6orf134 aa 115-187.Sequence: EVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAIDRPSQKLL KFLNKHYNLETTVPQVNNFVIFE Database link: Q5SQI0
Specifically acetylates Lys-40 in alpha-tubulin on the lumenal side of microtubules. May affect microtubule stability and regulate microtubule dynamics. May be involved in neuron development.
Citations
Publication ()
Have you cited DPABH-14642 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ATAT1 (aa 115-187) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
