Recombinant fragment corresponding to Human C6orf134 aa 115-187.Sequence: EVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAIDRPSQKLL KFLNKHYNLETTVPQVNNFVIFE Database link: Q5SQI0
Specifically acetylates Lys-40 in alpha-tubulin on the lumenal side of microtubules. May affect microtubule stability and regulate microtubule dynamics. May be involved in neuron development.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-14642 in a publication? Let us know and earn a reward for your research.
Castro-Castro, A; Janke, C; et al. ATAT1/MEC-17 acetyltransferase and HDAC6 deacetylase control a balance of acetylation of alpha-tubulin and cortactin and regulate MT1-MMP trafficking and breast tumor cell invasion. EUROPEAN JOURNAL OF CELL BIOLOGY 91:950-960(2012).
Kalebic, N; Sorrentino, S; et al. alpha TAT1 is the major alpha-tubulin acetyltransferase in mice. NATURE COMMUNICATIONS 4:-(2013).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-ATAT1 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis