Anti-ALDH16A1 polyclonal antibody (DPABH-12951)

Rabbit anti-Human ALDH16A1 (aa 19-68) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket


Host Species
Antibody Isotype
Species Reactivity
Synthetic peptide within Human ALDH16A1 aa 19-68 (N terminal). The exact sequence is proprietary. Isoform 2 of ALDH16A1.Sequence: YGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQDPITGENL Database link: Q8IZ83-2


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
ALDH16A1; aldehyde dehydrogenase 16 family, member A1; aldehyde dehydrogenase family 16 member A1; MGC10204
Entrez Gene ID
UniProt ID


Have you cited DPABH-12951 in a publication? Let us know and earn a reward for your research.


Keymoosi, H; Gheytanchi, E; et al. ALDH1 in Combination with CD44 as Putative Cancer Stem Cell Markers are Correlated with Poor Prognosis in Urothelial Carcinoma of the Urinary Bladder. ASIAN PACIFIC JOURNAL OF CANCER PREVENTION 15:2013-2020(2014).

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !

Online Inquiry

Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-ALDH16A1 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket