AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. The sequence is VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGK ATFLDAWE
Conjugate
Unconjugated
Target
Alternative Names
AKR1B10; aldo-keto reductase family 1, member B10 (aldose reductase); HIS; HSI; ARL1; ARL-1; ALDRLn; AKR1B11; AKR1B12; aldo-keto reductase family 1 member B10; ARP; hARP; SI reductase; aldose reductase-like 1; small intestine reductase; aldose reductase-l
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
Pathway
Disease; Fructose and mannose metabolism; Galactose metabolism; Glycerolipid metabolism
Citations
Publication ()
Have you cited DPAB-DC2559 in a publication? Let us know and earn a reward for your research.
My Review for Anti-AKR1B10 (aa 76-143) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
