Rabbit Anti-Human AHR Polyclonal Antibody (DPABH-26525)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant Protein, antigen sequence: NWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLYSIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEI
Conjugate
Unconjugated

Applications


Application Notes
IHC: 1:200 - 1:500
ICC-IF: 1-4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Target


Alternative Names
AHR; aryl hydrocarbon receptor; bHLHe76; AH-receptor; ah receptor; aromatic hydrocarbon receptor
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-26525 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Mizutani, N; Nabe, T; et al. IL-17A Promotes the Exacerbation of IL-33-Induced Airway Hyperresponsiveness by Enhancing Neutrophilic Inflammation via CXCR2 Signaling in Mice. JOURNAL OF IMMUNOLOGY 192:1372-1384(2014).
Lindell, DM; Lane, TE; et al. CXCL10/CXCR3-mediated responses promote immunity to respiratory syncytial virus infection by augmenting dendritic cell and CD8(+) T cell efficacy. EUROPEAN JOURNAL OF IMMUNOLOGY 38:2168-2179(2008).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket