Rabbit Anti-Human AGTR1 Polyclonal Antibody (DPABH-18508)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant Protein, antigen sequence: LQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKP
Conjugate
Unconjugated

Applications


Application Notes
IHC: 1:50-1:200
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human adipose tissue shows high expression.

Target


Alternative Names
AGTR1; angiotensin II receptor, type 1; AT1; AG2S; AT1B; AT1R
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-18508 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Sun, YX; Liao, YH; et al. Influence of autoantibodies against AT(1) receptor and AGTR1 polymorphisms on candesartan-based antihypertensive regimen Results from the Study of Optimal Treatment in Hypertensive Patients with Anti-AT(1)-Receptor Autoantibodies trial. JOURNAL OF THE AMERICAN SOCIETY OF HYPERTENSION 8:21-27(2014).
Rhodes, DR; Ateeq, B; et al. AGTR1 overexpression defines a subset of breast cancer and confers sensitivity to losartan, an AGTR1 antagonist. PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 106:10284-10289(2009).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket