Anti-AATF polyclonal antibody (DPAB-DC1312)

Mouse anti-Human AATF (aa 151-250) polyclonal antibody for WB, ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human, Rat
Immunogen
AATF (AAH00591, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. The sequence is VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT
Conjugate
Unconjugated

Target


Alternative Names
AATF; apoptosis antagonizing transcription factor; DED; BFR2; CHE1; CHE-1
Entrez Gene ID
UniProt ID

Product Background


Pathway
Cell death signalling via NRAGE, NRIF and NADE; Regulation of retinoblastoma protein; Signalling by NGF;

Citations


Have you cited DPAB-DC1312 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Sato, T; Selleri, C; et al. Expression and modulation of cellular receptors for interferon-gamma, tumour necrosis factor, and Fas on human bone marrow CD34(+) cells. BRITISH JOURNAL OF HAEMATOLOGY 97:356-365(1997).
Welters, ID; Menzebach, A; et al. Morphine inhibits AP-1 activity and CD 14 expression in leukocytes by a nitric oxide and opioid receptor-dependent mechanism. EUROPEAN JOURNAL OF ANAESTHESIOLOGY 24:958-965(2007).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket