Anti-AATF polyclonal antibody (DPAB-DC1312)

Mouse anti-Human AATF (aa 151-250) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human, Rat
Immunogen
AATF (AAH00591, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. The sequence is VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT
Conjugate
Unconjugated

Target


Alternative Names
AATF; apoptosis antagonizing transcription factor; DED; BFR2; CHE1; CHE-1
Entrez Gene ID
UniProt ID

Product Background


Pathway
Cell death signalling via NRAGE, NRIF and NADE; Regulation of retinoblastoma protein; Signalling by NGF;

Citations


Have you cited DPAB-DC1312 in a publication? Let us know and earn a reward for your research.

References


Bellido, T; O'Brien, CA; et al. Transcriptional activation of the p21(WAF1,CIP1,SDI1) gene by interleukin-6 type cytokines - A prerequisite for their pro-differentiating and anti-apoptotic effects on human osteoblastic cells. JOURNAL OF BIOLOGICAL CHEMISTRY 273:21137-21144(1998).
Yam, JWP; Chan, KW; et al. Transcriptional regulation of the promoter of the rat frizzled related protein gene by CREB. ONCOGENE 22:3901-3910(2003).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-AATF polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket