Anti-ALS2CR12 polyclonal antibody (CABT-BL265)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide corresponding to a region within the N-terminal amino acids 35-84 (SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETN KSFYEVINVSP)of Human ALS2CR12
Conjugate
Unconjugated

Applications


Application Notes
P-ELISA: 1:62500
WB: 1 μg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
ALS2CR12; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein; Amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12; Amyotrophic lat
Entrez Gene ID
UniProt ID

Citations


Have you cited CABT-BL265 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Choi, E; Cho, C; et al. Expression of a sperm flagellum component encoded by the Als2cr12 gene. GENE EXPRESSION PATTERNS 11:327-333(2011).
Fujihara, Y; Murakami, M; et al. Sperm equatorial segment protein 1, SPESP1, is required for fully fertile sperm in mouse. JOURNAL OF CELL SCIENCE 123:1531-1536(2010).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket