Anti-ABF1 polyclonal antibody (CABT-BL160)

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
S. cerevisiae
Immunogen
Fusion protein: RGLDDESGPTHGNDSGNHRHNEEDDVHTQMTKNYSDVVND EDINVAIANAVANVDSQSNNKHDGKDDDATNNNDGQDNNT NNDHNNNSNINNNNVGSHGI, corresponding to amino acids 201-300 of S. cerevisiae ABF1.
Conjugate
Unconjugated

Applications


Application Notes
WB: 1:1000
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
ABF1; Abf1p; ARS binding factor 1; BAF1; Bidirectionally acting factor; DNA replication enhancer-binding protein OBF1
Entrez Gene ID
UniProt ID

Citations


Have you cited CABT-BL160 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Feng, L; Wang, B; et al. Identification and characterization of Saccharomyces cerevisiae Cdc6 DNA-binding properties. MOLECULAR BIOLOGY OF THE CELL 11:1673-1685(2000).
UPTON, T; WILTSHIRE, S; et al. ABF1 SER-720 IS A PREDOMINANT PHOSPHORYLATION SITE FOR CASEIN KINASE-II OF SACCHAROMYCES-CEREVISIAE. JOURNAL OF BIOLOGICAL CHEMISTRY 270:16153-16159(1995).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket